PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G33900.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 575aa    MW: 62796.7 Da    PI: 8.3229
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G33900.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.12.7e-106495132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g WT+eEde l +av+ + g++Wk+I ++ +
  OMERI01G33900.3 64 KGGWTPEEDETLRKAVEAYKGRNWKKIEQRYN 95
                     688************************99876 PP

2Myb_DNA-binding45.22.2e-14111150848
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      Ed++++d+vk++G+  W+ Ia+ ++ gR +kqc++rw+++l
  OMERI01G33900.3 111 EDDQIIDLVKKYGPTKWSVIAKALP-GRIGKQCRERWHNHL 150
                      9************************.*************97 PP

3Myb_DNA-binding60.44e-19156199146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WTteE++ l++a++ +G++ W+ Ia+ ++ gRt++++k++w++
  OMERI01G33900.3 156 KDAWTTEEEQALINAHRIYGNK-WAEIAKVLP-GRTDNSIKNHWNS 199
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.50459102IPR017877Myb-like domain
SuperFamilySSF466899.33E-76095IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-86193IPR009057Homeodomain-like
SMARTSM007170.3363109IPR001005SANT/Myb domain
PfamPF002494.9E-86495IPR001005SANT/Myb domain
PROSITE profilePS5129414.777100150IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-23110158IPR009057Homeodomain-like
SMARTSM007179.7E-9110152IPR001005SANT/Myb domain
CDDcd001671.13E-12111150No hitNo description
PfamPF002494.0E-13111150IPR001005SANT/Myb domain
SuperFamilySSF466892.66E-29129211IPR009057Homeodomain-like
PROSITE profilePS5129428.34151205IPR017930Myb domain
SMARTSM007175.3E-18155203IPR001005SANT/Myb domain
PfamPF002496.0E-17156199IPR001005SANT/Myb domain
CDDcd001671.39E-14158201No hitNo description
Gene3DG3DSA:1.10.10.601.3E-22159204IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006096Biological Processglycolytic process
GO:0003677Molecular FunctionDNA binding
GO:0004807Molecular Functiontriose-phosphate isomerase activity
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MGAMAMVEQE GCVENRQPLA ASSSSVSDGS SYGGGLAQMS PPVSSSANSI SGLRRTSGPI  60
RRAKGGWTPE EDETLRKAVE AYKGRNWKKI EQRYNACIDG KRFLILNLSK EDDQIIDLVK  120
KYGPTKWSVI AKALPGRIGK QCRERWHNHL NPEIRKDAWT TEEEQALINA HRIYGNKWAE  180
IAKVLPGRTD NSIKNHWNSS LRKKQDMYNT SNNMVVPKLL VHDKFKDKPK LMAMEGHLDL  240
NKAPIINSKD QPGTAHWSNC SGFLSRSSLP TAQPLTSHEA SVVDGSAVTL VAQALESDSV  300
RGKGLEIDSV HEKGLEVNSA PDHTGNSWTI QLEAAPSKGE AELSLKNEAR SLGPLCYQIP  360
NMEDVVPVSS SLFSDHLTGN HTSEHCGDEI LSPAGCTTPP PTKGKLTSQL SVDSILKSAA  420
NSFPGTPSIL KRRKRDKSTP VSVSEMKISG SNTDRFYTPM GMEPATATPE SFKTTSFLSL  480
GSLDGSVKSF DVSPQYRARS KRMALTKTVE KQLDFSSDGL DTCGSEILNS PCNNSQSTLS  540
ITEAPKLKEK EHGEHAVQLE NLTKNFAHTT NLDVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-47632045158MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-47632045158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1431436RRKRDK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402120.0FJ940212.1 Oryza sativa Japonica Group clone KCS635B12 Myb-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616493.10.0PREDICTED: transcription factor MYB122
RefseqXP_015616500.10.0PREDICTED: transcription factor MYB122
TrEMBLA0A0E0CA480.0A0A0E0CA48_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g62410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.22e-87myb domain protein 3r-5